CDSN polyclonal antibody (A01)
  • CDSN polyclonal antibody (A01)

CDSN polyclonal antibody (A01)

Ref: AB-H00001041-A01
CDSN polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant CDSN.
Información adicional
Size 50 uL
Gene Name CDSN
Gene Alias D6S586E|HTSS|S
Gene Description corneodesmosin
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq YLVPGMTYSKGKIYPVGYFTKENPVKGSPGVPSFAAGPPISEGKYFSSNP
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen CDSN (NP_001255, 306 a.a. ~ 355 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 1041

Enviar un mensaje


CDSN polyclonal antibody (A01)

CDSN polyclonal antibody (A01)