CDO1 monoclonal antibody (M09), clone 4B4
  • CDO1 monoclonal antibody (M09), clone 4B4

CDO1 monoclonal antibody (M09), clone 4B4

Ref: AB-H00001036-M09
CDO1 monoclonal antibody (M09), clone 4B4

Información del producto

Mouse monoclonal antibody raised against a partial recombinant CDO1.
Información adicional
Size 100 ug
Gene Name CDO1
Gene Alias -
Gene Description cysteine dioxygenase, type I
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq NLKETLFAWPDKKSNEMVKKSERVLRENQCAYINDSIGLHRVENISHTEPAVSLHLYSPPFDTCHAFDQRTGHKNKVTMTFHSKFGIRTPNATSGSLENN
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen CDO1 (NP_001792.2, 101 a.a. ~ 200 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 1036
Clone Number 4B4
Iso type IgG2b Kappa

Enviar un mensaje


CDO1 monoclonal antibody (M09), clone 4B4

CDO1 monoclonal antibody (M09), clone 4B4