CDKN2D purified MaxPab rabbit polyclonal antibody (D01P)
  • CDKN2D purified MaxPab rabbit polyclonal antibody (D01P)

CDKN2D purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00001032-D01P
CDKN2D purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human CDKN2D protein.
Información adicional
Size 100 ug
Gene Name CDKN2D
Gene Alias INK4D|p19|p19-INK4D
Gene Description cyclin-dependent kinase inhibitor 2D (p19, inhibits CDK4)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IF
Immunogen Prot. Seq MLLEEVRAGDRLSGAAARGDVQEVRRLLHRELVHPDALNRFGKTALQVMMFGSTAIALELLKQGASPNVQDTSGTSPVHDAARTGFLDTLKVLVEHGADVNVPDGTGALPIHLAVQEGHTAVVSFLAAESDLHRRDARGLTPLELALQRGAQDLVDILQGHMVAPL
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen CDKN2D (NP_001791.1, 1 a.a. ~ 166 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 1032

Enviar un mensaje


CDKN2D purified MaxPab rabbit polyclonal antibody (D01P)

CDKN2D purified MaxPab rabbit polyclonal antibody (D01P)