Ver mas grande
CDKN2A monoclonal antibody (M06), clone 3F3
AB-H00001029-M06
Producto nuevo
CDKN2A monoclonal antibody (M06), clone 3F3
Comprando este producto generará 3 Biopuntos. Su cesta contiene un total 3 Biopuntos puede ser convertido en un Biobonos Descuento 12.00EUR.
Hoja técnica
| Size | 100 ug |
| Gene Name | CDKN2A |
| Gene Alias | ARF|CDK4I|CDKN2|CMM2|INK4|INK4a|MLM|MTS1|TP16|p14|p14ARF|p16|p16INK4|p16INK4a|p19 |
| Gene Description | cyclin-dependent kinase inhibitor 2A (melanoma, p16, inhibits CDK4) |
| Storage Conditions | Store at -20ºC or lower. Aliquot to avoid repeated freezing and thawing. |
| Application Key | WB-Tr,WB-Re,S-ELISA,ELISA,IF |
| Immunogen Prot. Seq | MMMGSAQVAELLLLHGAEPNCADPATLTRPVHDAAREGFLDTLVVLHRAGARLDVRDAWGRLPVDLAEELGHRDVARYLRAAAGGTRGSNHARIDAAEGPSDIPD |
| Antigen species Target species | Human |
| Quality control testing | Antibody Reactive Against Recombinant Protein. |
| Immunogen | CDKN2A (AAH15960, 1 a.a. ~ 105 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Storage Buffer | In 1x PBS, pH 7.4 |
| Gene ID | 1029 |
| Clone Number | 3F3 |
| Iso type | IgG2a Kappa |
Más información
Mouse monoclonal antibody raised against a full-length recombinant CDKN2A.