CDKN1C polyclonal antibody (A01)
  • CDKN1C polyclonal antibody (A01)

CDKN1C polyclonal antibody (A01)

Ref: AB-H00001028-A01
CDKN1C polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant CDKN1C.
Información adicional
Size 50 uL
Gene Name CDKN1C
Gene Alias BWCR|BWS|KIP2|WBS|p57
Gene Description cyclin-dependent kinase inhibitor 1C (p57, Kip2)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq MSDASLRSTSTMERLVARGTFPVLVRTSACRSLFGPVDHEELSRELQARLAELNAEDQNRWDYDFQQDMPLRGPGRLQWTEVDSDSVPAFYRETVQVGRC
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen CDKN1C (NP_000067, 1 a.a. ~ 100 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 1028

Enviar un mensaje


CDKN1C polyclonal antibody (A01)

CDKN1C polyclonal antibody (A01)