CDK7 purified MaxPab rabbit polyclonal antibody (D01P)
  • CDK7 purified MaxPab rabbit polyclonal antibody (D01P)

CDK7 purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00001022-D01P
CDK7 purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human CDK7 protein.
Información adicional
Size 100 ug
Gene Name CDK7
Gene Alias CAK1|CDKN7|MO15|STK1|p39MO15
Gene Description cyclin-dependent kinase 7
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Tr,PLA-Ce
Immunogen Prot. Seq MALDVKSRAKRYEKLDFLGEGQFATVYKARDKNTNQIVAIKKIKLGHRSEAKDGINRTALREIKLLQELSHPNIIGLLDAFGHKSNISLVFDFMETDLEVIIKDNSLVLTPSHIKAYMLMTLQGLEYLHQHWILHRDLKPNNLLLDENGVLKLADFGLAKSFGSPNRAYTHQVVTRWYRAPELLFGARMYGVGVDMWAVGCILAELLLRVPFLPGDSDLDQLTRIFETLGTPTEEQWPDMCSLPDYVTFKSFPGI
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen CDK7 (NP_001790.1, 1 a.a. ~ 346 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 1022

Enviar un mensaje


CDK7 purified MaxPab rabbit polyclonal antibody (D01P)

CDK7 purified MaxPab rabbit polyclonal antibody (D01P)