CDK6 monoclonal antibody (M01J), clone 8H4
  • CDK6 monoclonal antibody (M01J), clone 8H4

CDK6 monoclonal antibody (M01J), clone 8H4

Ref: AB-H00001021-M01J
CDK6 monoclonal antibody (M01J), clone 8H4

Información del producto

Mouse monoclonal antibody raised against a partial recombinant CDK6.
This product is belong to Cell Culture Grade Antibody (CX Grade).
Información adicional
Size 100 ug
Gene Name CDK6
Gene Alias MGC59692|PLSTIRE|STQTL11
Gene Description cyclin-dependent kinase 6
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Tr,WB-Re,IHC-P,S-ELISA,ELISA,PLA-Ce,IF
Immunogen Prot. Seq KDGLCRADQQYECVAEIGEGAYGKVFKARDLKNGGRFVALKRVRVQTGEEGMPLSTIREVAVLRHLETFEHPNVVRLFDVCTVSRTDRETKLTLVFE
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen CDK6 (NP_001250.1, 3 a.a. ~ 99 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 1021
Clone Number 8H4
Iso type IgG1 Kappa

Enviar un mensaje


CDK6 monoclonal antibody (M01J), clone 8H4

CDK6 monoclonal antibody (M01J), clone 8H4