CDK3 monoclonal antibody (M01), clone 3C12
  • CDK3 monoclonal antibody (M01), clone 3C12

CDK3 monoclonal antibody (M01), clone 3C12

Ref: AB-H00001018-M01
CDK3 monoclonal antibody (M01), clone 3C12

Información del producto

Mouse monoclonal antibody raised against a partial recombinant CDK3.
Información adicional
Size 100 ug
Gene Name CDK3
Gene Alias -
Gene Description cyclin-dependent kinase 3
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,WB-Re,IHC-P,S-ELISA,ELISA
Immunogen Prot. Seq DSEIDQLFRIFRMLGTPSEDTWPGVTQLPDYKGSFPKWTRKGLEEIVPNLEPEGRDLLMQLLQYDPSQRITAKTALAHPYFSSPEPSPAARQYVLQRFRH
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen CDK3 (NP_001249, 206 a.a. ~ 305 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 1018
Clone Number 3C12
Iso type IgG1 Kappa

Enviar un mensaje


CDK3 monoclonal antibody (M01), clone 3C12

CDK3 monoclonal antibody (M01), clone 3C12