CDH17 monoclonal antibody (M01), clone 1H3
  • CDH17 monoclonal antibody (M01), clone 1H3

CDH17 monoclonal antibody (M01), clone 1H3

Ref: AB-H00001015-M01
CDH17 monoclonal antibody (M01), clone 1H3

Información del producto

Mouse monoclonal antibody raised against a partial recombinant CDH17.
Información adicional
Size 100 ug
Gene Name CDH17
Gene Alias CDH16|FLJ26931|HPT-1|HPT1|MGC138218|MGC142024
Gene Description cadherin 17, LI cadherin (liver-intestine)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Re,IHC-P,S-ELISA,ELISA
Immunogen Prot. Seq EGKFSGPLKPMTFSIYEGQEPSQIIFQFKANPPAVTFELTGETDNIFVIEREGLLYYNRALDRETRSTHNLQVAALDANGIIVEGPVPITIEVKDINDNRPTFLQSKY
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen CDH17 (NP_004054, 24 a.a. ~ 131 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 1015
Clone Number 1H3
Iso type IgG1 Kappa

Enviar un mensaje


CDH17 monoclonal antibody (M01), clone 1H3

CDH17 monoclonal antibody (M01), clone 1H3