CDH17 polyclonal antibody (A01)
  • CDH17 polyclonal antibody (A01)

CDH17 polyclonal antibody (A01)

Ref: AB-H00001015-A01
CDH17 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant CDH17.
Información adicional
Size 50 uL
Gene Name CDH17
Gene Alias CDH16|FLJ26931|HPT-1|HPT1|MGC138218|MGC142024
Gene Description cadherin 17, LI cadherin (liver-intestine)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq EGKFSGPLKPMTFSIYEGQEPSQIIFQFKANPPAVTFELTGETDNIFVIEREGLLYYNRALDRETRSTHNLQVAALDANGIIVEGPVPITIEVKDINDNRPTFLQSKY
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen CDH17 (NP_004054, 24 a.a. ~ 131 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 1015

Enviar un mensaje


CDH17 polyclonal antibody (A01)

CDH17 polyclonal antibody (A01)