CDH11 monoclonal antibody (M01), clone 4D10
  • CDH11 monoclonal antibody (M01), clone 4D10

CDH11 monoclonal antibody (M01), clone 4D10

Ref: AB-H00001009-M01
CDH11 monoclonal antibody (M01), clone 4D10

Información del producto

Mouse monoclonal antibody raised against a partial recombinant CDH11.
Información adicional
Size 100 ug
Gene Name CDH11
Gene Alias CAD11|CDHOB|OB|OSF-4
Gene Description cadherin 11, type 2, OB-cadherin (osteoblast)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key S-ELISA,ELISA
Immunogen Prot. Seq PIVTISADDKDDTANGPRFIFSLPPEIIHNPNFTVRDNRDNTAGVYARRGGFSRQKQDLYLLPIVISDGGIPPMSSTNTLTIKVCGCDVNGALLSCNAEAYILNAGLST
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen CDH11 (NP_001788, 509 a.a. ~ 617 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 1009
Clone Number 4D10
Iso type IgG2b Kappa

Enviar un mensaje


CDH11 monoclonal antibody (M01), clone 4D10

CDH11 monoclonal antibody (M01), clone 4D10