CDH4 monoclonal antibody (M01), clone 2E2
  • CDH4 monoclonal antibody (M01), clone 2E2

CDH4 monoclonal antibody (M01), clone 2E2

Ref: AB-H00001002-M01
CDH4 monoclonal antibody (M01), clone 2E2

Información del producto

Mouse monoclonal antibody raised against a partial recombinant CDH4.
Información adicional
Size 100 ug
Gene Name CDH4
Gene Alias CAD4|FLJ22202|FLJ40547|MGC126700|MGC138355|RCAD
Gene Description cadherin 4, type 1, R-cadherin (retinal)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq AADADVDPNIGPYVFELPFVPAAVRKNWTITRLNGDYAQLSLRILYLEAGMYDVPIIVTDSGNPPLSNTSIIKVKVCPCDDNGDCTTIGAVAAAGLGTGA
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen CDH4 (NP_001785, 635 a.a. ~ 734 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 1002
Clone Number 2E2
Iso type IgG1 Kappa

Enviar un mensaje


CDH4 monoclonal antibody (M01), clone 2E2

CDH4 monoclonal antibody (M01), clone 2E2