CDH1 purified MaxPab rabbit polyclonal antibody (D01P)
  • CDH1 purified MaxPab rabbit polyclonal antibody (D01P)

CDH1 purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00000999-D01P
CDH1 purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human CDH1 protein.
Información adicional
Size 100 ug
Gene Name CDH1
Gene Alias Arc-1|CD324|CDHE|ECAD|LCAM|UVO
Gene Description cadherin 1, type 1, E-cadherin (epithelial)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti
Immunogen Prot. Seq MGPWSRSLSALLLLLQVSSWLCQEPEPCHPGFDAESYTFTVPRRHLERGRVLGRVNFEDCTGRQRTAYFSLDTRFKVGTDGVITVKRPLRFHNPQIHFLVYAWDSTYRKFSTKVTLNTVGHHHRPPPHQASVSGIQAELLTFPNSSPGLRRQKRDWVIPPISCPENEKGPFPKNLVQIKSNKDKEGKVFYSITGQGADTPPVGVFIIERETGWLKVTEPLDRERIATYTLFSHAVSSNGNAVEDPMEILITVTDQ
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian tissue lysate.
Immunogen CDH1 (ENSP00000261769, 1 a.a. ~ 882 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 999

Enviar un mensaje


CDH1 purified MaxPab rabbit polyclonal antibody (D01P)

CDH1 purified MaxPab rabbit polyclonal antibody (D01P)