CDC42 purified MaxPab rabbit polyclonal antibody (D01P)
  • CDC42 purified MaxPab rabbit polyclonal antibody (D01P)

CDC42 purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00000998-D01P
CDC42 purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human CDC42 protein.
Información adicional
Size 100 ug
Gene Name CDC42
Gene Alias CDC42Hs|G25K
Gene Description cell division cycle 42 (GTP binding protein, 25kDa)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,PLA-Ce
Immunogen Prot. Seq MQTIKCVVVGDGAVGKTCLLISYTTNKFPSEYVPTVFDNYAVTVMIGGEPYTLGLFDTAGQEDYDRLRPLSYPQTDVFLVCFSVVSPSSFENVKEKWVPEITHHCPKTPFLLVGTQIDLRDDPSTIEKLAKNKQKPITPETAEKLARDLKAVKYVECSALTQKGLKNVFDEAILAALEPPEPKKSRRCVLL
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen CDC42 (NP_001782.1, 1 a.a. ~ 191 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 998

Enviar un mensaje


CDC42 purified MaxPab rabbit polyclonal antibody (D01P)

CDC42 purified MaxPab rabbit polyclonal antibody (D01P)