CDC25C purified MaxPab rabbit polyclonal antibody (D02P)
  • CDC25C purified MaxPab rabbit polyclonal antibody (D02P)

CDC25C purified MaxPab rabbit polyclonal antibody (D02P)

Ref: AB-H00000995-D02P
CDC25C purified MaxPab rabbit polyclonal antibody (D02P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human CDC25C protein.
Información adicional
Size 100 ug
Gene Name CDC25C
Gene Alias CDC25
Gene Description cell division cycle 25 homolog C (S. pombe)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MSTELFSSTREEGSSGSGPSFRSNQRKMLNLLLERDTSFTVCPDVPRTPVGKFLGDSANLSILSGGTPKCCLDLSNLSSGEITATQLTTSADLDETGHLDSSGLQEVHLAGMNHDQHLMKCSPAQLLCSTPNGLDRGHRKRDAMCSSSANKENDNGNLVDSEMKYLGSPITTVPKLDKNPNLGEDQAEEISDELMEFSLKDQEAKVSRSGLYRSPSMPENLNRPRLKQVEKFKDNTIPDKVKKKYFSGQGKLRKG
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen CDC25C (AAH19089.1, 1 a.a. ~ 473 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 995

Enviar un mensaje


CDC25C purified MaxPab rabbit polyclonal antibody (D02P)

CDC25C purified MaxPab rabbit polyclonal antibody (D02P)