CDC25A monoclonal antibody (M01), clone 3D5
  • CDC25A monoclonal antibody (M01), clone 3D5

CDC25A monoclonal antibody (M01), clone 3D5

Ref: AB-H00000993-M01
CDC25A monoclonal antibody (M01), clone 3D5

Información del producto

Mouse monoclonal antibody raised against a partial recombinant CDC25A.
Información adicional
Size 100 ug
Gene Name CDC25A
Gene Alias CDC25A2
Gene Description cell division cycle 25 homolog A (S. pombe)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,S-ELISA,ELISA,PLA-Ce
Immunogen Prot. Seq PVRPVSRGCLHSHGLQEGKDLFTQRQNSAPARMLSSNERDSSEPGNFIPLFTPQSPVTATLSDEDDGFVDLLDGENLKNEEETPSCMASLWTAPLVMRTT
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen CDC25A (AAH07401, 151 a.a. ~ 250 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 993
Clone Number 3D5
Iso type IgG2a Kappa

Enviar un mensaje


CDC25A monoclonal antibody (M01), clone 3D5

CDC25A monoclonal antibody (M01), clone 3D5