CDC5L polyclonal antibody (A01)
  • CDC5L polyclonal antibody (A01)

CDC5L polyclonal antibody (A01)

Ref: AB-H00000988-A01
CDC5L polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant CDC5L.
Información adicional
Size 50 uL
Gene Name CDC5L
Gene Alias CEF1|KIAA0432|PCDC5RP|dJ319D22.1|hCDC5
Gene Description CDC5 cell division cycle 5-like (S. pombe)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,ELISA
Immunogen Prot. Seq ILLGGYQSRAMGLMKQLNDLWDQIEQAHLELRTFEELKKHEDSAIPRRLECLKEDVQRQQEREKELQHRYADLLLEKETLKSKF
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen CDC5L (NP_001244, 719 a.a. ~ 802 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 988

Enviar un mensaje


CDC5L polyclonal antibody (A01)

CDC5L polyclonal antibody (A01)