CDC2 monoclonal antibody (M03), clone 1G10
  • CDC2 monoclonal antibody (M03), clone 1G10

CDC2 monoclonal antibody (M03), clone 1G10

Ref: AB-H00000983-M03
CDC2 monoclonal antibody (M03), clone 1G10

Información del producto

Mouse monoclonal antibody raised against a partial recombinant CDC2.
Información adicional
Size 100 ug
Gene Name CDC2
Gene Alias CDC28A|CDK1|DKFZp686L20222|MGC111195
Gene Description cell division cycle 2, G1 to S and G2 to M
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,ELISA,IF
Immunogen Prot. Seq DQLFRIFRALGTPNNEVWPEVESLQDYKNTFPKWKPGSLASHVKNLDENGLDLLSKMLIYDPAKRISGKMALNHPYFNDLDNQIKKM
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen CDC2 (AAH14563, 211 a.a. ~ 297 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 983
Clone Number 1G10
Iso type IgG1

Enviar un mensaje


CDC2 monoclonal antibody (M03), clone 1G10

CDC2 monoclonal antibody (M03), clone 1G10