CDC2 polyclonal antibody (A01)
  • CDC2 polyclonal antibody (A01)

CDC2 polyclonal antibody (A01)

Ref: AB-H00000983-A01
CDC2 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant CDC2.
Información adicional
Size 50 uL
Gene Name CDC2
Gene Alias CDC28A|CDK1|DKFZp686L20222|MGC111195
Gene Description cell division cycle 2, G1 to S and G2 to M
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq DQLFRIFRALGTPNNEVWPEVESLQDYKNTFPKWKPGSLASHVKNLDENGLDLLSKMLIYDPAKRISGKMALNHPYFNDLDNQIKKM
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen CDC2 (AAH14563, 211 a.a. ~ 297 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 983

Enviar un mensaje


CDC2 polyclonal antibody (A01)

CDC2 polyclonal antibody (A01)