CD79B purified MaxPab rabbit polyclonal antibody (D01P)
  • CD79B purified MaxPab rabbit polyclonal antibody (D01P)

CD79B purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00000974-D01P
CD79B purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human CD79B protein.
Información adicional
Size 100 ug
Gene Name CD79B
Gene Alias B29|IGB
Gene Description CD79b molecule, immunoglobulin-associated beta
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MARLALSPVPSHWMVALLLLLSAEPVPAARSEDRYRNPKGSACSRIWQSPRFIARKRGFTVKMHCYMNSASGNVSWLWKQEMDENPQQLKLEKGRMEESQNESLATLTIQGIRFEDNGIYFCQQKCNNTSEVYQGCGTELRVMGFSTLAQLKQRNTLKDGIIMIQTLLIILFIIVPIFLLLDKDDSKAGMEEDHTYEGLDIDQTATYEDIVTLRTGEVKWSVGEHPGQE
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen CD79B (NP_000617.1, 1 a.a. ~ 229 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 974

Enviar un mensaje


CD79B purified MaxPab rabbit polyclonal antibody (D01P)

CD79B purified MaxPab rabbit polyclonal antibody (D01P)