CD79A purified MaxPab rabbit polyclonal antibody (D01P)
  • CD79A purified MaxPab rabbit polyclonal antibody (D01P)

CD79A purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00000973-D01P
CD79A purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human CD79A protein.
Información adicional
Size 100 ug
Gene Name CD79A
Gene Alias IGA|MB-1
Gene Description CD79a molecule, immunoglobulin-associated alpha
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MPGGPGVLQALPATIFLLFLLSAVYLGPGCQALWMHKVPASLMVSLGEDAHFQCPHNSSNNANVTWWRVLHGNYTWPPEFLGPGEDPNGTLIIQNVNKSHGGIYVCRVQEGNESYQQSCGTYLRVRQPPPRPFLDMGEGTKNRIITAEGIILLFCAVVPGTLLLFRKRWQNEKLGLDAGDEYEDENLYEGLNLDDCSMYEDISRGLQGTYQDVGSLNIGDVQLEKP
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen CD79A (NP_001774.1, 1 a.a. ~ 226 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 973

Enviar un mensaje


CD79A purified MaxPab rabbit polyclonal antibody (D01P)

CD79A purified MaxPab rabbit polyclonal antibody (D01P)