CD70 MaxPab rabbit polyclonal antibody (D01)
  • CD70 MaxPab rabbit polyclonal antibody (D01)

CD70 MaxPab rabbit polyclonal antibody (D01)

Ref: AB-H00000970-D01
CD70 MaxPab rabbit polyclonal antibody (D01)

Información del producto

Rabbit polyclonal antibody raised against a full-length human CD70 protein.
Información adicional
Size 100 uL
Gene Name CD70
Gene Alias CD27L|CD27LG|TNFSF7
Gene Description CD70 molecule
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IP
Immunogen Prot. Seq MPEEGSGCSVRRRPYGCVLRAALVPLVAGLVICLVVCIQRFAQAQQQLPLESLGWDVAELQLNHTGPQQDPRLYWQGGPALGRSFLHGPELDKGQLRIHRDGIYMVHIQVTLAICSSTTASRHHPTTLAVGICSPASRSISLLRLSFHQGCTIASQRLTPLARGDTLCTNLTGTLLPSRNTDETFFGVQWVRP
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen CD70 (NP_001243.1, 1 a.a. ~ 193 a.a) full-length human protein.
Storage Buffer No additive
Gene ID 970

Enviar un mensaje


CD70 MaxPab rabbit polyclonal antibody (D01)

CD70 MaxPab rabbit polyclonal antibody (D01)