CD70 purified MaxPab mouse polyclonal antibody (B01P)
  • CD70 purified MaxPab mouse polyclonal antibody (B01P)

CD70 purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00000970-B01P
CD70 purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human CD70 protein.
Información adicional
Size 50 ug
Gene Name CD70
Gene Alias CD27L|CD27LG|TNFSF7
Gene Description CD70 molecule
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MPEEGSGCSVRRRPYGCVLRAALVPLVAGLVICLVVCIQRFAQAQQQLPLESLGWDVAELQLNHTGPQQDPRLYWQGGPALGRSFLHGPELDKGQLRIHRDGIYMVHIQVTLAICSSTTASRHHPTTLAVGICSPASRSISLLRLSFHQGCTIASQRLTPLARGDTLCTNLTGTLLPSRNTDETFFGVQWVRP
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen CD70 (NP_001243, 1 a.a. ~ 193 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 970

Enviar un mensaje


CD70 purified MaxPab mouse polyclonal antibody (B01P)

CD70 purified MaxPab mouse polyclonal antibody (B01P)