CD69 monoclonal antibody (M07), clone 4H3
  • CD69 monoclonal antibody (M07), clone 4H3

CD69 monoclonal antibody (M07), clone 4H3

Ref: AB-H00000969-M07
CD69 monoclonal antibody (M07), clone 4H3

Información del producto

Mouse monoclonal antibody raised against a partial recombinant CD69.
Información adicional
Size 100 ug
Gene Name CD69
Gene Alias CLEC2C
Gene Description CD69 molecule
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key IP,S-ELISA,ELISA
Immunogen Prot. Seq VGYQRKCYFISTVKRSWTSAQNACSEHGATLAVIDSEKDMNFLKRYAGREEHWVGLKKEPGHPWKWSNGKEFNNWFNVTGSDKCVFLKNTEVSSMECEKNLYWICNKPYK
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen CD69 (AAH07037, 90 a.a. ~ 199 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 969
Clone Number 4H3
Iso type IgG2a Kappa

Enviar un mensaje


CD69 monoclonal antibody (M07), clone 4H3

CD69 monoclonal antibody (M07), clone 4H3