CD68 polyclonal antibody (A01)
  • CD68 polyclonal antibody (A01)

CD68 polyclonal antibody (A01)

Ref: AB-H00000968-A01
CD68 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant CD68.
Información adicional
Size 50 uL
Gene Name CD68
Gene Alias DKFZp686M18236|GP110|SCARD1
Gene Description CD68 molecule
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Re,ELISA
Immunogen Prot. Seq NGSQPCVHLQAQIQIRVMYTTQGGGEAWGISVLNPNKTKVQGSCEGAHPHLLLSFPYGHLSFGFMQDLQQKVVYLSYMAVEYNVSFPHAAKWTFSAQNA
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen CD68 (NP_001242, 164 a.a. ~ 262 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 968

Enviar un mensaje


CD68 polyclonal antibody (A01)

CD68 polyclonal antibody (A01)