CD63 DNAxPab
  • CD63 DNAxPab

CD63 DNAxPab

Ref: AB-H00000967-W03P
CD63 DNAxPab

Información del producto

Rabbit polyclonal antibody raised against a partial-length human CD63 DNA using DNAx™ Immune technology.
Información adicional
Size 100 ug
Gene Name CD63
Gene Alias LAMP-3|ME491|MLA1|OMA81H|TSPAN30
Gene Description CD63 molecule
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IF-Tr,Flow Cyt-Tr
Immunogen Prot. Seq VGAQLVLSQTIIQGATPGSLLPVVIIAVGVFLFLVAFVGCCGACKENYCLMITFAIFLSLIMLVEVAAAIAGYVFRDKVMSEFNNNFRQQMENYPKNNHTASILDRMQADFKCCGAANYTDWEKIPSMSKNRVPDSCCINVTVGCGINFNEKAIHKEGCVEKIGGWLRKNV
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen CD63 (NP_001771.1, 33 a.a. ~ 203 a.a) partial-length human DNA
Storage Buffer In 1x PBS, pH 7.4
Gene ID 967

Enviar un mensaje


CD63 DNAxPab

CD63 DNAxPab