CD59 purified MaxPab mouse polyclonal antibody (B05P)
  • CD59 purified MaxPab mouse polyclonal antibody (B05P)

CD59 purified MaxPab mouse polyclonal antibody (B05P)

Ref: AB-H00000966-B05P
CD59 purified MaxPab mouse polyclonal antibody (B05P)

Información del producto

Mouse polyclonal antibody raised against a full-length human CD59 protein.
Información adicional
Size 50 ug
Gene Name CD59
Gene Alias 16.3A5|1F5|EJ16|EJ30|EL32|FLJ38134|FLJ92039|G344|HRF-20|HRF20|MAC-IP|MACIF|MEM43|MGC2354|MIC11|MIN1|MIN2|MIN3|MIRL|MSK21|p18-20
Gene Description CD59 molecule, complement regulatory protein
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MGIQGGSVLFGLLLVLAVFCHSGHSLQCYNCPNPTADCKTAVNCSSDFDACLITKAGLQVYNKCWKFEHCNFNDVTTRLRENELTYYCCKKDLCNFNEQLENGGTSLSEKTVLLLVTPFLAAAWSLHP
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen CD59 (AAH01506, 1 a.a. ~ 128 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 966

Enviar un mensaje


CD59 purified MaxPab mouse polyclonal antibody (B05P)

CD59 purified MaxPab mouse polyclonal antibody (B05P)