CD58 purified MaxPab rabbit polyclonal antibody (D01P)
  • CD58 purified MaxPab rabbit polyclonal antibody (D01P)

CD58 purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00000965-D01P
CD58 purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human CD58 protein.
Información adicional
Size 100 ug
Gene Name CD58
Gene Alias LFA-3|LFA3
Gene Description CD58 molecule
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MVAGSDAGRALGVLSVVCLLHCFGFISCFSQQIYGVVYGNVTFHVPSNVPLKEVLWKKQKDKVAELENSEFRAFSSFKNRVYLDTVSGSLTIYNLTSSDEDEYEMESPNITDTMKFFLYVLESLPSPTLTCALTNGSIEVQCMIPEHYNSHRGLIMYSWDCPMEQCKRNSTSIYFKMENDLPQKIQCTLSNPLFNTTSSIILTTCIPSSGHSRHRYALIPIPLAVITTCIVLYMNGILKCDRKPDRTNSN
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen CD58 (NP_001770.1, 1 a.a. ~ 250 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 965

Enviar un mensaje


CD58 purified MaxPab rabbit polyclonal antibody (D01P)

CD58 purified MaxPab rabbit polyclonal antibody (D01P)