CD48 purified MaxPab rabbit polyclonal antibody (D01P)
  • CD48 purified MaxPab rabbit polyclonal antibody (D01P)

CD48 purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00000962-D01P
CD48 purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human CD48 protein.
Información adicional
Size 100 ug
Gene Name CD48
Gene Alias BCM1|BLAST|BLAST1|MEM-102|SLAMF2|hCD48|mCD48
Gene Description CD48 molecule
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Tr
Immunogen Prot. Seq MCSRGWDSCLALELLLLPLSLLVTSIQGHLVHMTVVSGSNVTLNISESLPENYKQLTWFYTFDQKIVEWDSRKSKYFESKFKGRVRLDPQSGALYISKVQKEDNSTYIMRVLKKTGNEQEWKIKLQVLDPVPKPVIKIEKIEDMDDNCYLKLSCVIPGESVNYTWYGDKRPFPKELQNSVLETTLMPHNYSRCYTCQVSNSVSSKNGTVCLSPPCTLARSFGVEWIASWLVVTVPTILGLLLT
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen CD48 (NP_001769.2, 1 a.a. ~ 243 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 962

Enviar un mensaje


CD48 purified MaxPab rabbit polyclonal antibody (D01P)

CD48 purified MaxPab rabbit polyclonal antibody (D01P)