Ver mas grande
CD40 monoclonal antibody (K02), clone 4G2
AB-H00000958-K02
Producto nuevo
CD40 monoclonal antibody (K02), clone 4G2
Comprando este producto generará 3 Biopuntos. Su cesta contiene un total 3 Biopuntos puede ser convertido en un Biobonos Descuento 12.00EUR.
Hoja técnica
| Size | 100 ug |
| Gene Name | CD40 |
| Gene Alias | Bp50|CDW40|MGC9013|TNFRSF5|p50 |
| Gene Description | CD40 molecule, TNF receptor superfamily member 5 |
| Storage Conditions | Store at -20ºC or lower. Aliquot to avoid repeated freezing and thawing. |
| Application Key | WB-Re,ELISA |
| Immunogen Prot. Seq | EPPTACREKQYLINSQCCSLCQPGQKLVSDCTEFTETECLPCGESEFLDTWNRETHCHQHKYCDPNLGLRVQQKGTSETDTICTCEEGWHCTSEACESCVLHRSCSPGFGVKQIATGVSDTICEPCPVGFFSNVSSAFEKCHPWTSCETKDLVVQQAGTNKTDVVCGPQDRLR |
| Antigen species Target species | Human |
| Quality control testing | Antibody Reactive Against Recombinant Protein. |
| Immunogen | Purified CD40 (AAH12419.1 , 21 a.a. - 193 a.a.) human recombinant protein with His-Flag-StrepII tag at N-terminus expressed in human cells. |
| Storage Buffer | In 1x PBS, pH 7.4 |
| Gene ID | 958 |
| Clone Number | 4G2 |
Más información
Rabbit monoclonal antibody raised against a partial recombinant CD40.