ENTPD5 monoclonal antibody (M07), clone 4A5
  • ENTPD5 monoclonal antibody (M07), clone 4A5

ENTPD5 monoclonal antibody (M07), clone 4A5

Ref: AB-H00000957-M07
ENTPD5 monoclonal antibody (M07), clone 4A5

Información del producto

Mouse monoclonal antibody raised against a partial recombinant ENTPD5.
Información adicional
Size 100 ug
Gene Name ENTPD5
Gene Alias CD39L4|MGC163357|MGC163359|NTPDase-5|PCPH
Gene Description ectonucleoside triphosphate diphosphohydrolase 5
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,S-ELISA,ELISA
Immunogen Prot. Seq EEVQRGSFYAFSYYYDRAVDTDMIDYEKGGILKVEDFERKAREVCDNLENFTSGSPFLCMDLSYITALLKDGFGFADSTVLQ
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen ENTPD5 (NP_001240, 319 a.a. ~ 400 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 957
Clone Number 4A5
Iso type IgG2b Kappa

Enviar un mensaje


ENTPD5 monoclonal antibody (M07), clone 4A5

ENTPD5 monoclonal antibody (M07), clone 4A5