ENTPD5 polyclonal antibody (A01)
  • ENTPD5 polyclonal antibody (A01)

ENTPD5 polyclonal antibody (A01)

Ref: AB-H00000957-A01
ENTPD5 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant ENTPD5.
Información adicional
Size 50 uL
Gene Name ENTPD5
Gene Alias CD39L4|MGC163357|MGC163359|NTPDase-5|PCPH
Gene Description ectonucleoside triphosphate diphosphohydrolase 5
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq EEVQRGSFYAFSYYYDRAVDTDMIDYEKGGILKVEDFERKAREVCDNLENFTSGSPFLCMDLSYITALLKDGFGFADSTVLQ
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen ENTPD5 (NP_001240, 319 a.a. ~ 400 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 957

Enviar un mensaje


ENTPD5 polyclonal antibody (A01)

ENTPD5 polyclonal antibody (A01)