ENTPD3 monoclonal antibody (M02), clone 2A4
  • ENTPD3 monoclonal antibody (M02), clone 2A4

ENTPD3 monoclonal antibody (M02), clone 2A4

Ref: AB-H00000956-M02
ENTPD3 monoclonal antibody (M02), clone 2A4

Información del producto

Mouse monoclonal antibody raised against a partial recombinant ENTPD3.
Información adicional
Size 100 ug
Gene Name ENTPD3
Gene Alias CD39L3|FLJ93839|HB6|NTPDase-3
Gene Description ectonucleoside triphosphate diphosphohydrolase 3
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key S-ELISA,ELISA
Immunogen Prot. Seq QDVPRAFEECMQKVKGQVPSHLHGSTPIHLGATAGMRLLRLQNETAANEVLESIQSYFKSQPFDFRGAQIISGQEEGVYGWITANYLMGNFLEKNLWHMWVHPHGVETTG
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen ENTPD3 (NP_001239, 107 a.a. ~ 216 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 956
Clone Number 2A4
Iso type IgG2a Kappa

Enviar un mensaje


ENTPD3 monoclonal antibody (M02), clone 2A4

ENTPD3 monoclonal antibody (M02), clone 2A4