ENTPD3 purified MaxPab rabbit polyclonal antibody (D01P)
  • ENTPD3 purified MaxPab rabbit polyclonal antibody (D01P)

ENTPD3 purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00000956-D01P
ENTPD3 purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human ENTPD3 protein.
Información adicional
Size 100 ug
Gene Name ENTPD3
Gene Alias CD39L3|FLJ93839|HB6|NTPDase-3
Gene Description ectonucleoside triphosphate diphosphohydrolase 3
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Tr
Immunogen Prot. Seq MFTVLTRQPCEQAGLKALYRTPTVIALVVLLVSIVVLVSITVIQIHKQEVLPPGLKYGIVLDAGSSRTTVYVYQWPAEKENNTGVVSQTFKCSVKGSGISSYGNNPQDVPRAFEECMQKVKGQVPSHLHGSTPIHLGATAGMRLLRLQNETAANEVLESIQSYFKSQPFDFRGAQIISGQEEGVYGWITANYLMGNFLEKNLWHMWVHPHGVETTGALDLGGASTQISFVAGEKMDLNTSDIMQVSLYGYVYTLY
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen ENTPD3 (AAH29869.1, 1 a.a. ~ 452 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 956

Enviar un mensaje


ENTPD3 purified MaxPab rabbit polyclonal antibody (D01P)

ENTPD3 purified MaxPab rabbit polyclonal antibody (D01P)