SIGLEC6 monoclonal antibody (M02), clone 2G6
  • SIGLEC6 monoclonal antibody (M02), clone 2G6

SIGLEC6 monoclonal antibody (M02), clone 2G6

Ref: AB-H00000946-M02
SIGLEC6 monoclonal antibody (M02), clone 2G6

Información del producto

Mouse monoclonal antibody raised against a partial recombinant SIGLEC6.
Información adicional
Size 100 ug
Gene Name SIGLEC6
Gene Alias CD327|CD33L|CD33L1|CDw327|OBBP1|SIGLEC-6
Gene Description sialic acid binding Ig-like lectin 6
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,WB-Re,IP,ELISA
Immunogen Prot. Seq KTRRKKAAQPVQNTDDVNPVMVSGSRGHQHQFQTGIVSDHPAEAGPISEDEQELHYAVLHFHKVQPQEPKVTDTEYSEIKIHK
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen SIGLEC6 (NP_001236, 371 a.a. ~ 453 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 946
Clone Number 2G6
Iso type IgG2b Kappa

Enviar un mensaje


SIGLEC6 monoclonal antibody (M02), clone 2G6

SIGLEC6 monoclonal antibody (M02), clone 2G6