SIGLEC6 purified MaxPab rabbit polyclonal antibody (D01P)
  • SIGLEC6 purified MaxPab rabbit polyclonal antibody (D01P)

SIGLEC6 purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00000946-D01P
SIGLEC6 purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human SIGLEC6 protein.
Información adicional
Size 100 ug
Gene Name SIGLEC6
Gene Alias CD327|CD33L|CD33L1|CDw327|OBBP1|SIGLEC-6
Gene Description sialic acid binding Ig-like lectin 6
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Tr
Immunogen Prot. Seq MQGAQEASASEMLPLLLPLLWAGALAQERRFQLEGPESLTVQEGLCVLVPCRLPTTLPASYYGYGYWFLEGADVPVATNDPDEEVQEETRGRFHLLWDPRRKNCSLSIRDARRRDNAAYFFRLKSKWMKYGYTSSKLSVRVMALTHRPNISIPGTLESGHPSNLTCSVPWVCEQGTPPIFSWMSAAPTSLGPRTTQSSVLTITPRPQDHSTNLTCQVTFPGAGVTMERTIQLNVSSFKILQNTSSLPVLEGQALR
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen SIGLEC6 (ENSP00000344064, 1 a.a. ~ 437 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 946

Enviar un mensaje


SIGLEC6 purified MaxPab rabbit polyclonal antibody (D01P)

SIGLEC6 purified MaxPab rabbit polyclonal antibody (D01P)