CD33 purified MaxPab rabbit polyclonal antibody (D01P)
  • CD33 purified MaxPab rabbit polyclonal antibody (D01P)

CD33 purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00000945-D01P
CD33 purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human CD33 protein.
Información adicional
Size 100 ug
Gene Name CD33
Gene Alias FLJ00391|SIGLEC-3|SIGLEC3|p67
Gene Description CD33 molecule
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Tr
Immunogen Prot. Seq MPLLLLLPLLWAGALAMDPNFWLQVQESVTVQEGLCVLVPCTFFHPIPYYDKNSPVHGYWFREGAIISGDSPVATNKLDQEVQEETQGRFRLLGDPSRNNCSLSIVDARRRDNGSYFFRMERGSTKYSYKSPQLSVHVTDLTHRPKILIPGTLEPGHSKNLTCSVSWACEQGTPPIFSWLSAAPTSLGPRTTHSSVLIITPRPQDHGTNLTCQVKFAGAGVTTERTIQLNVTYVPQNPTTGIFPGDGSGKQETRA
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen CD33 (AAH28152.1, 1 a.a. ~ 364 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 945

Enviar un mensaje


CD33 purified MaxPab rabbit polyclonal antibody (D01P)

CD33 purified MaxPab rabbit polyclonal antibody (D01P)