TNFSF8 polyclonal antibody (A01)
  • TNFSF8 polyclonal antibody (A01)

TNFSF8 polyclonal antibody (A01)

Ref: AB-H00000944-A01
TNFSF8 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant TNFSF8.
Información adicional
Size 50 uL
Gene Name TNFSF8
Gene Alias CD153|CD30L|CD30LG|MGC138144
Gene Description tumor necrosis factor (ligand) superfamily, member 8
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq NNSVDLKLELLINKHIKKQALVTVCESGMQTKHVYQNLSQFLLDYLQVNTTISVNVDTFQYIDTSTFPLENVLSIFLYSNSD
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen TNFSF8 (NP_001235, 153 a.a. ~ 234 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 944

Enviar un mensaje


TNFSF8 polyclonal antibody (A01)

TNFSF8 polyclonal antibody (A01)