CD86 purified MaxPab mouse polyclonal antibody (B01P)
  • CD86 purified MaxPab mouse polyclonal antibody (B01P)

CD86 purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00000942-B01P
CD86 purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human CD86 protein.
Información adicional
Size 50 ug
Gene Name CD86
Gene Alias B7-2|B70|CD28LG2|LAB72|MGC34413
Gene Description CD86 molecule
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MDPQCTMGLSNILFVMAFLLSGAAPLKIQAYFNETADLPCQFANSQNQSLSELVVFWQDQENLVLNEVYLGKEKFDSVHSKYMGRTSFDSDSWTLRLHNLQIKDKGLYQCIIHHKKPTGMIRIHQMNSELSVLANFSQPEIVPISNITENVYINLTCSSIHGYPEPKKMSVLLRTKNSTIEYDGIMQKSQDNVTELYDVSISLSVSFPDVTSNMTIFCILETDKTRLLSSPFSIELEDPQPPPDHIPWITAVLPT
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen CD86 (AAH40261.1, 1 a.a. ~ 329 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 942

Enviar un mensaje


CD86 purified MaxPab mouse polyclonal antibody (B01P)

CD86 purified MaxPab mouse polyclonal antibody (B01P)