CD80 monoclonal antibody (M18), clone 8E10
  • CD80 monoclonal antibody (M18), clone 8E10

CD80 monoclonal antibody (M18), clone 8E10

Ref: AB-H00000941-M18
CD80 monoclonal antibody (M18), clone 8E10

Información del producto

Mouse monoclonal antibody raised against a partial recombinant CD80.
Información adicional
Size 100 ug
Gene Name CD80
Gene Alias CD28LG|CD28LG1|LAB7
Gene Description CD80 molecule
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq SVKADFPTPSISDFEIPTSNIRRIICSTSGGFPEPHLSWLENGEELNAINTTVSQDPETELYAVSSKLDFNMTTNHSFMCLIKYGHLRVNQTFN
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen CD80 (AAH11399.2, 137 a.a. ~ 230 a.a) partial recombinant protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 941
Clone Number 8E10
Iso type IgG1 Kappa

Enviar un mensaje


CD80 monoclonal antibody (M18), clone 8E10

CD80 monoclonal antibody (M18), clone 8E10