CD28 monoclonal antibody (M26), clone 6A7
  • CD28 monoclonal antibody (M26), clone 6A7

CD28 monoclonal antibody (M26), clone 6A7

Ref: AB-H00000940-M26
CD28 monoclonal antibody (M26), clone 6A7

Información del producto

Mouse monoclonal antibody raised against a partial recombinant CD28.
Información adicional
Size 100 ug
Gene Name CD28
Gene Alias MGC138290|Tp44
Gene Description CD28 molecule
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key ELISA
Immunogen Prot. Seq GNKILVKQSPMLVAYDNAVNLSCKYSYNLFSREFRASLHKGLDSAVEVCVVYGNYSQQLQVYSKTGFNCDGKLGNESVTFYLQNLYVNQTDIYFCKIEVMYPPPYLDNEKSNGTIIHVKGKHLCPSPLFPGPSKP
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen CD28 (NP_006130.1, 18 a.a. ~ 152 a.a) partial recombinant protein with GST tag.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 940
Clone Number 6A7
Iso type IgG2a Kappa

Enviar un mensaje


CD28 monoclonal antibody (M26), clone 6A7

CD28 monoclonal antibody (M26), clone 6A7