CD28 monoclonal antibody (M22), clone 4B5
  • CD28 monoclonal antibody (M22), clone 4B5

CD28 monoclonal antibody (M22), clone 4B5

Ref: AB-H00000940-M22
CD28 monoclonal antibody (M22), clone 4B5

Información del producto

Mouse monoclonal antibody raised against a partial recombinant CD28.
Información adicional
Size 100 ug
Gene Name CD28
Gene Alias MGC138290|Tp44
Gene Description CD28 molecule
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq GNKILVKQSPMLVAYDNAVNLSCKYSYNLFSREFRASLHKGLDSAVEVCVVYGNYSQQLQVYSKTGFNCDGKLGNESVTFYLQNLYVNQTDIYFCKIEVMYPPPYLDNEKSNGTIIHVKGKHLCPSPLFPGPSKP
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen CD28 (NP_006130.1, 18 a.a. ~ 152 a.a) partial recombinant protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 940
Clone Number 4B5
Iso type IgG1 Kappa

Enviar un mensaje


CD28 monoclonal antibody (M22), clone 4B5

CD28 monoclonal antibody (M22), clone 4B5