CD28 purified MaxPab mouse polyclonal antibody (B01P)
  • CD28 purified MaxPab mouse polyclonal antibody (B01P)

CD28 purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00000940-B01P
CD28 purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human CD28 protein.
Información adicional
Size 50 ug
Gene Name CD28
Gene Alias MGC138290|Tp44
Gene Description CD28 molecule
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MLRLLLALNLFPSIQVTGNKILVKQSPMLVAYDNAVNLSCKYSYNLFSREFRASLHKGLDSAVEVCVVYGNYSQQLQVYSKTGFNCDGKLGNESVTFYLQNLYVNQTDIYFCKIEVMYPPPYLDNEKSNGTIIHVKGKHLCPSPLFPGPSKPFWVLVVVGGVLACYSLLVTVAFIIFWVRSKRSRLLHSDYMNMTPRRPGPTRKHYQPYAPPRDFAAYRS
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen CD28 (NP_006130, 1 a.a. ~ 220 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 940

Enviar un mensaje


CD28 purified MaxPab mouse polyclonal antibody (B01P)

CD28 purified MaxPab mouse polyclonal antibody (B01P)