CD24 monoclonal antibody (M04), clone 1C4
  • CD24 monoclonal antibody (M04), clone 1C4

CD24 monoclonal antibody (M04), clone 1C4

Ref: AB-H00000934-M04
CD24 monoclonal antibody (M04), clone 1C4

Información del producto

Mouse monoclonal antibody raised against a full-length recombinant CD24.
Información adicional
Size 100 ug
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq MGRAMVARLGLGLLLLALLLPTQIYSSETTTGTSSNSSQSTSNSGLAPNPTNATTKAAGGALQSTASLFVVSLSLLHLYS
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen CD24 (AAH07674, 1 a.a. ~ 80 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 934
Clone Number 1C4
Iso type IgG2a Kappa

Enviar un mensaje


CD24 monoclonal antibody (M04), clone 1C4

CD24 monoclonal antibody (M04), clone 1C4