MS4A3 purified MaxPab mouse polyclonal antibody (B01P)
  • MS4A3 purified MaxPab mouse polyclonal antibody (B01P)

MS4A3 purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00000932-B01P
MS4A3 purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human MS4A3 protein.
Información adicional
Size 50 ug
Gene Name MS4A3
Gene Alias CD20L|HTM4
Gene Description membrane-spanning 4-domains, subfamily A, member 3 (hematopoietic cell-specific)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MASHEVDNAELGSASARGTPGSEAGPEELNTSVYQPIDGSPDYQKAKLQVLGAIQILNAAMILALGVFLGSLQYPYHFQKHFFFFTFYTGYPIWGAVFFCSSGTLSVVAGIKPTRTWIQNSFGMNIASATIALVGTAFLSLNIAVNIQSLRSCHSSSESPDLCNYMGSISNGMVSLLLILTLLELCVTISTIAMWCNANCCNSREEISSPPNSV
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen MS4A3 (AAH08487, 1 a.a. ~ 214 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 932

Enviar un mensaje


MS4A3 purified MaxPab mouse polyclonal antibody (B01P)

MS4A3 purified MaxPab mouse polyclonal antibody (B01P)