CD19 monoclonal antibody (M02), clone 1C9
  • CD19 monoclonal antibody (M02), clone 1C9

CD19 monoclonal antibody (M02), clone 1C9

Ref: AB-H00000930-M02
CD19 monoclonal antibody (M02), clone 1C9

Información del producto

Mouse monoclonal antibody raised against a partial recombinant CD19.
Información adicional
Size 100 ug
Gene Name CD19
Gene Alias B4|MGC12802
Gene Description CD19 molecule
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,S-ELISA,ELISA,IF
Immunogen Prot. Seq QPGPPSEKAWQPGWTVNVEGSGELFRWNVSDLGGLGCGLKNRSSEGPSSPSGKLMSPKLYVWAKDRPEIWEGEPPCVPPRDSLNQSLSQD
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen CD19 (NP_001761, 98 a.a. ~ 187 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 930
Clone Number 1C9
Iso type IgG1 Kappa

Enviar un mensaje


CD19 monoclonal antibody (M02), clone 1C9

CD19 monoclonal antibody (M02), clone 1C9