CD19 polyclonal antibody (A01)
  • CD19 polyclonal antibody (A01)

CD19 polyclonal antibody (A01)

Ref: AB-H00000930-A01
CD19 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant CD19.
Información adicional
Size 50 uL
Gene Name CD19
Gene Alias B4|MGC12802
Gene Description CD19 molecule
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq QPGPPSEKAWQPGWTVNVEGSGELFRWNVSDLGGLGCGLKNRSSEGPSSPSGKLMSPKLYVWAKDRPEIWEGEPPCVPPRDSLNQSLSQD
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen CD19 (NP_001761, 98 a.a. ~ 187 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 930

Enviar un mensaje


CD19 polyclonal antibody (A01)

CD19 polyclonal antibody (A01)