CD8A monoclonal antibody (M10), clone 4B9
  • CD8A monoclonal antibody (M10), clone 4B9

CD8A monoclonal antibody (M10), clone 4B9

Ref: AB-H00000925-M10
CD8A monoclonal antibody (M10), clone 4B9

Información del producto

Mouse monoclonal antibody raised against a full-length recombinant CD8A.
Información adicional
Size 100 ug
Gene Name CD8A
Gene Alias CD8|Leu2|MAL|p32
Gene Description CD8a molecule
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key IP,S-ELISA,ELISA,IF
Immunogen Prot. Seq MALPVTALLLPLALLLHAARPSQFRVSPLDRTWNLGETVELKCQVLLSNPTSGCSWLFQPRGAAASPTFLLYLSQNKPKAAEGLDTQRFSGKRLGDTFVLTLSDFRRENEGCYFCSALSNSIMYFSHFVPVFLPAKPTTTPAPRPPTPAPTIASQPLSLRPEACRPAAGGAVHTRGLDFACDIYIWAPLAGTCGVLLLSLVITLYCNHRNRRRVCKCPRPVVKSGDKPSLSARYV
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen CD8A (AAH25715, 1 a.a. ~ 235 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 925
Clone Number 4B9
Iso type IgG2b Kappa

Enviar un mensaje


CD8A monoclonal antibody (M10), clone 4B9

CD8A monoclonal antibody (M10), clone 4B9