CD8A purified MaxPab mouse polyclonal antibody (B01P)
  • CD8A purified MaxPab mouse polyclonal antibody (B01P)

CD8A purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00000925-B01P
CD8A purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human CD8A protein.
Información adicional
Size 50 ug
Gene Name CD8A
Gene Alias CD8|Leu2|MAL|p32
Gene Description CD8a molecule
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Tr
Immunogen Prot. Seq MALPVTALLLPLALLLHAARPSQFRVSPLDRTWNLGETVELKCQVLLSNPTSGCSWLFQPRGAAASPTFLLYLSQNKPKAAEGLDTQRFSGKRLGDTFVLTLSDFRRENEGCYFCSALSNSIMYFSHFVPVFLPAKPTTTPAPRPPTPAPTIASQPLSLRPEACRPAAGGAVHTRGLDFACDIYIWAPLAGTCGVLLLSLVITLYCNHRNRRRVCKCPRPVVKSGDKPSLSARYV
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen CD8A (AAH25715.1, 1 a.a. ~ 235 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 925

Enviar un mensaje


CD8A purified MaxPab mouse polyclonal antibody (B01P)

CD8A purified MaxPab mouse polyclonal antibody (B01P)