CD5L monoclonal antibody (M01), clone 1C8
  • CD5L monoclonal antibody (M01), clone 1C8

CD5L monoclonal antibody (M01), clone 1C8

Ref: AB-H00000922-M01
CD5L monoclonal antibody (M01), clone 1C8

Información del producto

Mouse monoclonal antibody raised against a partial recombinant CD5L.
Información adicional
Size 100 ug
Gene Name CD5L
Gene Alias AIM|API6|PRO229|SP-ALPHA|Spalpha
Gene Description CD5 molecule-like
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,IP,S-ELISA,ELISA
Immunogen Prot. Seq QKGQWGTVCDDGWDIKDVAVLCRELGCGAASGTPSGILYEPPAEKEQKVLIQSVSCTGTEDTLAQCEQEEVYDCSHDEDAGASCENPESSFSPVPEGVRL
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen CD5L (AAH33586, 41 a.a. ~ 140 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 922
Clone Number 1C8
Iso type IgG2a Kappa

Enviar un mensaje


CD5L monoclonal antibody (M01), clone 1C8

CD5L monoclonal antibody (M01), clone 1C8